All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: RIGLH-25 (for 25μg)

Cat. No.: RIGLH-50 (for 50μg)

Cat. No.: RIGLH-100 (for 100μg)

Description

Immunoglobulin G (IgG) is a type of antibody that represents approximately 75% of serum antibodies in humans, making it the most common antibody in blood circulation. IgG molecules are produced and released by plasma B cells. Mammalian immunoglobulins feature two classes of light chains: lambda and kappa. These light chains typically exist in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.

Species

Rabbit

Expression Sequence

Protein sequence (with C-10*His)

QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Predicted MW: 13.0 kDa 

Observed MW: 17.0 kDa

Purity

＞95% by SDS-PAGE

Tag

with C-10*His

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.