All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: MT119H-25 (for 25μg)

Cat. No.: MT119H-50 (for 50μg)

Cat. No.: MT119H-100 (for 100μg)

Description

TMEM119, hailed as a microglia-specific transmembrane molecule, boasts robust expression unparalleled by other macrophages, immune cells, or neurons. This distinction renders it the foremost contender for microglia identification. Since its discovery, TMEM119 has emerged as a stalwart immunohistochemical marker for microglia in neurodegenerative diseases. Recently, an adapted protocol has even facilitated TMEM119 staining in postmortem cerebrospinal fluid samples from trauma cases, further underscoring its versatility and clinical utility.

Species

Mouse

Molecular Alias

Osteoblast induction factor (OBIF)

Accession

Q8R138

Expression Sequence

Protein sequence(Q8R138, Thr100-Val280, with C-10*His)

TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 20.8kDa 

Actual: 28kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.