All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HS100BH-50 (for 50μg)

Cat. No.: HS100BH-100 (for 100μg)

Cat. No.: HS100BH-500 (for 500μg)

Cat. No.: HS100BH-1k (for 1mg)

Description

S100 calcium-binding protein B (S100B) is a member of the S-100 protein family. These proteins are found in the cytoplasm and nucleus of a wide range of cells and are involved in regulating various cellular processes, such as cell cycle progression and differentiation. S100B is glial-specific and is primarily expressed by astrocytes, although not all astrocytes produce S100B. Research has shown that S100B is specifically expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. Serum levels of S100B increase in patients during the acute phase of brain damage. Over the past decade, S100B has emerged as a potential peripheral biomarker for blood–brain barrier (BBB) permeability and central nervous system (CNS) injury.

Species

Human

Molecular Alias

S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B

Accession

P04271

Expression Sequence

Protein sequence(P04271, Ser2-Glu92 with C-10*His)

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEGGGGSHHHHHHHHHH

Expression Host

E.coli

Molecular Weight

Theoretical: 12.4kDa 

Actual: 12kDa

Purity

95% by SDS-PAGE

Label

Unconjugated

Tag

His Tag

Form

Lyophilized Powder

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.