All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HS1A9H-25 (for 25μg)

Cat. No.: HS1A9H-50 (for 50μg)

Cat. No.: HS1A9H-100 (for 100μg)

Description

S100A9 is a member of the S100 family of proteins, characterized by two EF-hand calcium-binding motifs. These proteins are localized in the cytoplasm and/or nucleus of various cells and are involved in regulating numerous cellular processes, including cell cycle progression and differentiation. The S100 gene family comprises at least 13 members clustered on chromosome 1q21. S100A9 may inhibit casein kinase and has a significant role in intracellular functions. Specifically, S100A9 affects mitochondrial homeostasis within neutrophils. Neutrophils lacking S100A9 produce higher levels of mitochondrial superoxide and undergo increased suicidal NETosis in response to bacterial pathogens. Additionally, S100A9-deficient mice demonstrate protection against systemic Staphylococcus aureus infections, exhibiting lower bacterial burdens in the heart, indicating an organ-specific function for S100A9.

Species

Human

Molecular Alias

Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; S100 calcium-binding protein A9; CAGB, CFAG, MRP14

Accession

P06702

Expression Sequence

Protein sequence(P06702, Met1-Pro114, with C-10*His)

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPGGGGSHHHHHHHHHH

Expression Host

E.coli

Molecular Weight

Theoretical: 14.9kDa 

Actual: 15.0kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.