Amyloid β Peptide(42-1) human
$80.00 - $1,130.00
All products have special prices for bulk purchase, please contact for more details if required.
Cat. No.: BA421-0.2 (for 0.2mg)
Cat. No.: BA421-1 (for 1mg)
Cat. No.: BA421-5 (for 5mg)
Alternative names
β-Amyloid(42-1);Aβ(42-1)
Description
Amyloid β Peptide(42-1) is the reverse of Amyloid β Peptide(1-42). Inactive control peptide for amyloid β Peptide(1-42).
Purity
>95%(HPLC)
CAS Number
317366-82-8
Molecular Formula
C203H311N55O60S
Molecular Weight
4514.1
Sequence
(Three-Letter Code) Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp
Sequence
(One-Letter Code) AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Source
Synthetic
Reconstitution
Resuspend in any one of the following solvents: 1% NH4OH, 50mM Tris/150mM NaCl(pH 7.2),0.1% TFA, 5mM HCl, 2mM NaOH, at a concentration of 1mg/ml or less. DMSO may have high solubility. Sonicate for 30 seconds to 1 minute after it has gone into solution. Gently vortex to mix. To bring into your solution: After resuspension, add 5x or 10x buffer stock (PBS, TBS) and water to bring to 1x buffer.Do not store in 1% NH4OH, dilute immediately with PBS. Notes: Above are relevant information that may provide a guideline on how to dissolve this peptide. Solubility may vary from batch to batch due to solvent of crystallization, residual solvent content, polymorphism, salt versus free form, degree of hydration, solvent temperature, and dissolved oxygen. End users need to test the solvents & solubility and adapt to their own specific applications.
Storage
Store at -20°C or below, valid for at least one year. Since each freeze-thaw cycle of the peptide can cause partial inactivation, after preparing the corresponding concentration of storage solution for the first time (please prepare the storage solution according to the information in the Reconstitution section of the product description), it should be aliquoted and stored at -20°C or below to avoid repeated freeze-thaw cycles.
Notes
- This product is a lyophilized powder. Due to the deposition of trace amounts of peptides inside the vial during the lyophilization process, a thin or invisible layer of peptides may form. Therefore, before opening the vial, we recommend centrifuging at approximately 8,000-12,000g for 10-30 seconds in a centrifuge to collect the peptides adhered to the vial cap or wall at the bottom of the vial.
- This product is intended for scientific research by professionals only and should not be used for clinical diagnosis or treatment, food or drugs, and should not be stored in a regular household.
- For your safety and health, please wear laboratory attire and disposable gloves while handling.
Related:
- Amyloid β Peptide(1-42) human
- Amyloid β Peptide(42-1) human
- Amyloid β Peptide(1-40) human
- Amyloid β Peptide(40-1) human
SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.
Only for research and not intended for treatment of humans or animals
Journals Using SBS Genetech Products Universities Using SBS Genetech Products
SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory